68173
75
Zoom out
Zoom in
Previous page
1/103
Next page
(max.20characters.Thenentertheseparatemacrocommands.
Amacro’s command stringis limited to 26 characters. Each com
-
mand or button simulation consists of two characters. You can
therefore only link a maximum of 13 commands together, or, for
example,join 7 commands/ key strokesimulationswith afurther
12 digits.
Commands and keys for macro programming
A macro consists of various commands, orecall flash button strokes, that are compiled into one command sequence
and stored under a defined direct dialing key. When this function key is pressed, the individual commands
contained in the macro are executed one after the other.
The following commands are available for macro programming:
»B« Initiatingacall(sameasliftingthehandset)
»D« Endingacall(sameasreplacingthehandset)
»ELSE« Alternativecommand,ifarequiredcondition(e.g. »IFLA«oIFLB«)isnotfulfilled.
»IFLA«
»IFLB«
ExecutethismacroonlywhentheLEDforthefirstlevelisoffIFLA«)orflashesIFLB«). Ifthiscondition
isnotfulfilledtheprocedureisdiscontinued,orresumedafterthecommand»ELSE«(whereavailable).
»K« Keypadsequence;allofthefollowingcharacters/digitsaretransmittedasakeypadsequence.
»LA« DeactivateLED
»LB« TheLEDflashes
»LE« ActivateLED
»LZ« ActivateLEDfortwoseconds
»n« Dummynumber.
Ifanumber is enteredprior to executionof a macro(orfor example,dialed fromthe telephone) thisnum-
berisusedinplaceofthedummynumberinthemacro.
»P« Pause(1second)inthecommandsequence(betweentwocharacters/commands)
»RE« Re-establishthephone’sidlestate.
Ifthereisanactiveconnectionatthisphone,executionofthismacroiscanceledatthis point.
»SE« Activatingthespeaker(normalvolume)
»SA« Activatingthespeaker(lowvolume)
»T« DTMF-Sequenz:allofthefollowingcharacters/digitsaretransferredasDTMFdialing.
»TS« Testingaconnection.
If there is currently no connection active, or an outgoing connection can not be set up (for B. subscriber
busy),executionofthemacroiscanceledatthispoint.
If you wish to incorporate a telephone key into a macro, press the corresponding key during macro programming
(this is indicated, for example by » s5« in the display). All keys used for operating the telephone during macro
programming (e. g. save, change entry position, delete entry or cancel) cannot be incorporated into the macro by
simply actuating them, but need to be linked with the macro by means of the following commands.
»c« ActuationoftheC-button.
»esc« ActuationoftheESC-button.
»f« Actuationofthemenubutton.
»« Actuationoftheleftarrowbutton.
Programming numbers
71
75


Need help? Post your question in this forum.

Forumrules


Report abuse

Libble takes abuse of its services very seriously. We're committed to dealing with such abuse according to the laws in your country of residence. When you submit a report, we'll investigate it and take the appropriate action. We'll get back to you only if we require additional details or have more information to share.

Product:

For example, Anti-Semitic content, racist content, or material that could result in a violent physical act.

For example, a credit card number, a personal identification number, or an unlisted home address. Note that email addresses and full names are not considered private information.

Forumrules

To achieve meaningful questions, we apply the following rules:

Register

Register getting emails for Funkwerk CS410 at:


You will receive an email to register for one or both of the options.


Get your user manual by e-mail

Enter your email address to receive the manual of Funkwerk CS410 in the language / languages: English as an attachment in your email.

The manual is 0,9 mb in size.

 

You will receive the manual in your email within minutes. If you have not received an email, then probably have entered the wrong email address or your mailbox is too full. In addition, it may be that your ISP may have a maximum size for emails to receive.

The manual is sent by email. Check your email

If you have not received an email with the manual within fifteen minutes, it may be that you have a entered a wrong email address or that your ISP has set a maximum size to receive email that is smaller than the size of the manual.

The email address you have provided is not correct.

Please check the email address and correct it.

Your question is posted on this page

Would you like to receive an email when new answers and questions are posted? Please enter your email address.



Info